PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN14265.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 341aa    MW: 38560.6 Da    PI: 6.3661
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN14265.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.99.5e-182774148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT +Ed+ l+++++ +G g+W++ ar  g++Rt+k+c++rw++yl
       KHN14265.1 27 RGPWTVDEDLALINYIANHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 74
                     89********************************************97 PP

2Myb_DNA-binding48.42.1e-1580123146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
       KHN14265.1  80 RGNITLEEQLLILELHGRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 123
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.4372274IPR017930Myb domain
SuperFamilySSF466891.16E-3024121IPR009057Homeodomain-like
SMARTSM007171.4E-142676IPR001005SANT/Myb domain
PfamPF002493.7E-162774IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-222881IPR009057Homeodomain-like
CDDcd001673.00E-112974No hitNo description
PROSITE profilePS5129423.58975129IPR017930Myb domain
SMARTSM007171.0E-1379127IPR001005SANT/Myb domain
PfamPF002493.7E-1480123IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-2282128IPR009057Homeodomain-like
CDDcd001673.9E-795123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MEVKGRISNS TITTTTIQSE DEMDLRRGPW TVDEDLALIN YIANHGEGRW NSLARSAGLK  60
RTGKSCRLRW LNYLRPDVRR GNITLEEQLL ILELHGRWGN RWSKIAQYLP GRTDNEIKNY  120
WRTRVQKQAK QLKCDVNSKQ FKDAMRYLWM PRLVERIQAA AAAATTATAT VGSPTASASA  180
TTTITTNNNA TTYNYENNNN NNLNNSFEVH SGNMMLRNPA IMNINNFVGS HSYTPENNST  240
GASSDSFGAQ VSPVSDLTQD YYNNVTVENN NNNNNPNPEY YQQAHDQLSF LDCITSPSGL  300
FDFQSMEPNT PWIQSNVGDT STNGFWNVEN MLLFQQLSDN M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-252412124120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003546301.10.0PREDICTED: transcription factor MYB108
SwissprotQ9LDE19e-87MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0B2PYT70.0A0A0B2PYT7_GLYSO; Myb-related protein 305
TrEMBLI1MGB30.0I1MGB3_SOYBN; Uncharacterized protein
STRINGGLYMA15G14620.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.18e-84myb domain protein 78
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]